PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf15836g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 811aa    MW: 90341.7 Da    PI: 6.5531
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf15836g00006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3741.8e-23166267199
                               EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                               f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD 
  Niben101Scf15836g00006.1 166 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyKEQ-RPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDA 249
                               99****************************86333.45679******************************************** PP

                               EEEEE-SSSEE..EEEEE-S CS
                        B3  80 vvFkldgrsefelvvkvfrk 99 
                               v+F   + +++ l+++++r+
  Niben101Scf15836g00006.1 250 VLFL--RGEGGDLRLGIRRA 267
                               ****..4489999**99986 PP

2Auxin_resp114.78.2e-38292373182
                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                               +a+a+s ks+F+v+Y+Pras+++Fvv+++k++k++++++ v +Rfkm+f+ +ds+err+sG+v+g+sd+dp+rWpnSkWr+L
  Niben101Scf15836g00006.1 292 VATAVSAKSTFHVFYSPRASHADFVVPYQKYMKSINSRIPVRTRFKMRFDLDDSPERRYSGVVTGISDMDPFRWPNSKWRCL 373
                               6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.27E-44158284IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.0E-40159279IPR015300DNA-binding pseudobarrel domain
CDDcd100174.84E-22164266No hitNo description
PROSITE profilePS5086312.901166268IPR003340B3 DNA binding domain
PfamPF023622.4E-21166267IPR003340B3 DNA binding domain
SMARTSM010193.8E-23166268IPR003340B3 DNA binding domain
PfamPF065071.1E-31293373IPR010525Auxin response factor
SuperFamilySSF542771.13E-10665751No hitNo description
PfamPF023092.6E-6666756IPR033389AUX/IAA domain
PROSITE profilePS5174521.772672756IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 811 aa     Download sequence    Send to blast
MEIDLNHAVV SEVEKNACYN GECDKSGVGG SCVNCNLSTT STSSCSSNAS SSSSSLTLSS  60
IYMELWHACA GPLTSLPKKG NVVVYFPQGH MEEAVSVSPF SPIKMDFPTF GLQPQIFCKV  120
EDVQLLANKE NDESVAISLK EKEHENLGVD EEGNGVNPGK SASHMFCKTL TASDTSTHGG  180
FSVPRRAAED CFPPLDYKEQ RPSQELIAKD LHGVEWKFRH IYRGQPRRHL LTTGWSIFVS  240
QKNLVSGDAV LFLRGEGGDL RLGIRRAARP RNGLPESIIK AQYSGSDVLS AVATAVSAKS  300
TFHVFYSPRA SHADFVVPYQ KYMKSINSRI PVRTRFKMRF DLDDSPERRY SGVVTGISDM  360
DPFRWPNSKW RCLMVRWDED IMSNHQERVS PWEIDSSVSL PPLSIQSPRL KKLRTSQQAP  420
SLDSHFAGGS ALLDFEESVR SSKVLQGQEN LGLISPPYGC DKTVRPLDFE LQNVARHNLM  480
PTGMENIIVG DFVKTQPPTT YTGFLESNRF PKVLQGQEIC SLRSLTGKSD VNFGAWGKPE  540
FGCNVFSTYQ RPKANFYPLA SEGARNVFLP YNAMYRAGQD PVVHSYINYN FQRENPTLNQ  600
NSIQNGVRRE EGGMQKFANE QSPLEMSKLS IPETNFKNEN SGSLNAQASC KLFGFSLIKE  660
PSTPSSQSSG KRSCTKVHKQ GSLVGRAIDL SRLNGYEDLL GELERLFNME DLLRDPNKGW  720
RILYTDSEND MMVVGDDPWH EFCEVVSKIH IYTQEEVEKM TIEGISDDTR SCLEEAPPAF  780
MDASKSSSVG QPDSSPTMMA IKSINFPEHL R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-110453952353Auxin response factor 1
4ldw_A1e-110453952353Auxin response factor 1
4ldw_B1e-110453952353Auxin response factor 1
4ldx_A1e-110463953353Auxin response factor 1
4ldx_B1e-110463953353Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779766.10.0PREDICTED: auxin response factor 4
RefseqXP_016462299.10.0PREDICTED: auxin response factor 4-like
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLM1AE600.0M1AE60_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000208390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51432234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4